| 释义 | pert
 pertP0212100 (pûrt)adj. pert·er, pert·est 1. a.  High-spirited, lively, or cheerful: A pert receptionist greets each client.b.  Impudently bold; saucy: He was pert to his teacher. She gave a pert answer.2. a.  Attractive or stylish in appearance: a pert hat.b.  Small or firm and well-formed: a pert nose.[Middle English, unconcealed, bold, short for apert, obvious, frank (probably influenced by Old French aspert, espert, clever), from Old French, from Latin apertus, open, past participle of aperīre, to open; see wer- in Indo-European roots.]
 pert′ly adv.pert′ness n.
 pert(pɜːt) adj1. saucy, impudent, or forward2. jaunty: a pert little hat. 3. obsolete clever or brisk[C13: variant of earlier apert, from Latin apertus open, from aperīre to open; influenced by Old French aspert, from Latin expertus expert] ˈpertly adv ˈpertness n
 PERT(pɜːt) n acronym forprogramme evaluation and review techniquepert(pɜrt)
 adj.  -er, -est.   1.  boldly forward in speech or behavior; impertinent; saucy.    2.  jaunty and stylish; chic.    3.  lively; sprightly; in good health.    4.  Obs. clever.  [1200–50; Middle English, aph. variant of apert < Old French < Latin apertus open, past participle of aperīre; see aperient]  pert′ly, adv.    pert′ness, n.
 pert.pertaining.  Thesaurus| Adj. | 1. | pert - characterized by a lightly pert and exuberant quality; "a certain irreverent gaiety and ease of manner"impertinent, saucy, irreverentspirited - displaying animation, vigor, or liveliness | 
 pertadjective impudent, forward, smart, bold, fresh (informal), flip (informal), cheeky, brash, saucy, pushy (informal), sassy (U.S. informal), flippant, presumptuous, impertinent, insolent, lippy (U.S. & Canad. slang) a pert young hussypertadjective1. Very brisk, alert, and full of high spirits:animated, bouncy, chipper, dashing, high-spirited, lively, spirited, vivacious.Informal:  peppy.Idioms: bright-eyed and bushy-tailed, full of life.2. Rude and disrespectful:assuming, assumptive, audacious, bold, boldfaced, brash, brazen, cheeky, contumelious, familiar, forward, impertinent, impudent, insolent, malapert, nervy, overconfident, presuming, presumptuous, pushy, sassy, saucy, smart.Informal:  brassy, flip, fresh, smart-alecky, snippety, snippy, uppish, uppity.Slang:  wise.Translationsburschikoskessimpertinenteinsolentesfacciato
 PERT
 PERT[pərt]  (systems engineering) A management control tool for defining, integrating, and interrelating what must be done to accomplish a desired objective on time; a computer is used to compare current progress against planned objectives and give management the information needed for planning and decision making. Derived from program evaluation and review technique.PERTAn acronym for program evaluation and review technique; a planning, scheduling, and control procedure based upon the use of time-oriented networks which reflect the interrelationships and dependencies among the project tasks (activities). The major objectives of PERT are to give management improved ability to develop a project plan and to properly allocate resources within overall program time and cost limitations, to control the time and cost performance of the project, and to replan when significant departures from budget occur. The basic requirements of PERT, in its time or schedule form of application, are: 1. All individual tasks required to complete a given program must be visualized in a clear enough manner to be put down in a network composed of events and activities. An event denotes a specified program accomplishment at a particular instant in time. An activity represents the time and resources that are necessary to progress from one event to the next. 2. Events and activities must be sequenced on the network under a logical set of ground rules. 3. Time estimates can be made for each activity of the network on a three-way basis. Optimistic (minimum), most likely (modal), and pessimistic (maximum) performance time figures are estimated by the person or persons most familiar with the activity involved. The three-time estimates are used as a measure of uncertainty of the eventual activity duration. 4. Finally, critical path and slack times are computed. The critical path is that sequence of activities and events on the network that will require the greatest expected time to accomplish. Slack time is the difference between the earliest time that an activity may start (or finish) and its latest allowable start (or finish) time, as required to complete the project on schedule. 5. The difference between the pessimistic (b) and optimistic (a) activity performance times is used to compute the standard deviation () of the hypothetical distribution of activity performance times [= (b - a)/6]. The PERT procedure employs these expected times and standard deviations (σ2 is called variance) to compute the probability that an event will be on schedule, that is, will occur on or before its scheduled occurrence time. In the actual utilization of PERT, review and action by responsible managers is required, generally on a biweekly basis, concentrating on important critical path activities. A major advantage of PERT is the kind of planning required to create an initial network. Network development and critical path analysis reveal interdependencies and problem areas before the program begins that are often not obvious or well defined by conventional planning methods. program evaluation and review technique (PERT)A management control technique applied to building construction; determines what must be done to complete construction by a given date. Current construction progress is monitored on a computer and compared with the planned schedule so as to provide a management tool for further planning and decision making.
 PERT1. Acronym for “project evaluation and review technique.” 2.See program estimation revaluation technique.PERTProgram Evaluation and Review TechniquePert
 Pert(pûrt), Candace Beebe Born 1946. American biochemist noted for her study of brain chemicals and the locations of their receptors.PERT
 | Acronym | Definition | 
|---|
 | PERT➣Program Evaluation & Review Technique |  | PERT➣Program Evaluation and Review Techniques |  | PERT➣Project Evaluation and Review Technique (less common) |  | PERT➣Pancreatic Enzyme Replacement Therapy |  | PERT➣Psychiatric Emergency Response Team (San Diego, CA) |  | PERT➣Performance Evaluation and Review Technique |  | PERT➣Provincial Emergency Response Team (Ontario Provincial Police) |  | PERT➣Program Evaluation Research Task (less common; probably incorrect) |  | PERT➣Portfolio Evaluation and Review Technique (less common; probably incorrect) |  | PERT➣Prison Emergency Response Team |  | PERT➣Pilot Emissions Reduction Trading Project (Canada) |  | PERT➣Professional Emergency Response Team |  | PERT➣Progress Evaluation and Review Technique |  | PERT➣Physical Education & Recreational Training |  | PERT➣Parallel Element Reliability Test |  | PERT➣Program Event Reporting and Tracking |  | PERT➣Public Employees' Retirement Trust |  | PERT➣Process Engineering Review Team |  | PERT➣Problem & Enhancement Review Team (Sprint) |  | PERT➣Pi Eta Research Technology (Pi Eta Consulting Company; Singapore) | 
 pert
 Synonyms for pertadj impudentSynonymsimpudentforwardsmartboldfreshflipcheekybrashsaucypushysassyflippantpresumptuousimpertinentinsolentlippy
 Synonyms for pertadj very brisk, alert, and full of high spiritsSynonymsanimatedbouncychipperdashinghigh-spiritedlivelyspiritedvivaciouspeppy
 adj rude and disrespectfulSynonymsassumingassumptiveaudaciousboldboldfacedbrashbrazencheekycontumeliousfamiliarforwardimpertinentimpudentinsolentmalapertnervyoverconfidentpresumingpresumptuouspushysassysaucysmartbrassyflipfreshsmart-aleckysnippetysnippyuppishuppitywise
 Synonyms for pertadj characterized by a lightly pert and exuberant qualitySynonymsimpertinentsaucyirreverent
 Related Words |