| 释义 | flicker
 flick·er 1F0184200 (flĭk′ər)v. flick·ered, flick·er·ing, flick·ers v.intr.1.  To move waveringly; flutter: shadows flickering on the wall.2. a.  To burn or shine unsteadily or fitfully: The candle flickered before sputtering out.b.  To be displayed with fluctuating brightness: A movie flickered on the screen.3.  To appear briefly: A smile flickered on her face.v.tr. To cause to move waveringly.n.1.  A brief movement; a tremor.2.  An inconstant or wavering light.3.  A brief or slight sensation: a flicker of doubt.[Middle English flikeren, to flutter, from Old English flicerian.]
 
 flick·er 2F0184200 (flĭk′ər)n. Any of various large woodpeckers of the genus Colaptes of the Americas, having a long tail and large feet and often foraging on the ground, especially C. auratus, the northern flicker.[Perhaps from flick.]
 flicker(ˈflɪkə) vb1.  (intr) to shine with an unsteady or intermittent light: a candle flickers. 2.  (intr) to move quickly to and fro; quiver, flutter, or vibrate3.  (tr) to cause to flickern4. an unsteady or brief light or flame5. a swift quivering or fluttering movement6.  (Electronics) a visual sensation, often seen in a television image, produced by periodic fluctuations in the brightness of light at a frequency below that covered by the persistence of vision7.  (Film) the flickers  (plural) the US equivalent of flick22[Old English flicorian; related to Dutch flikkeren, Old Norse flökra to flutter] ˈflickeringly adv ˈflickery adj
 flicker(ˈflɪkə) n (Animals) any North American woodpecker of the genus Colaptes, esp C. auratus (yellow-shafted flicker), which has a yellow undersurface to the wings and tail[C19: perhaps imitative of the bird's call]flick•er1(ˈflɪk ər)
 v.i.    1.  to shine with a wavering light:  The candle flickered in the wind.    2.  to move to and fro; vibrate.    3.  to flutter.  v.t.    4.  to cause to flicker.  n.    5.  an unsteady flame or light.    6.  a flickering movement.    7.  a brief appearance or feeling:  a flicker of interest.    8.  Often, flickers.Slang.  flick 2.   [before 1000; Middle English flikeren (v.), Old English flicorian to flutter, c. Dutch flikkeren]  flick′er•ing•ly, adv.    flick′er•y, adj.
 flick•er2(ˈflɪk ər)
 n.   any of several North American woodpeckers of the genus Colaptes, having yellow or red underwings: now usu. considered a single species,  C. auratus.  [1800–10]
 flickerPast participle: flickered
 Gerund: flickering
 
 | Present | 
|---|
 | I flicker |  | you flicker |  | he/she/it flickers |  | we flicker |  | you flicker |  | they flicker | 
 | Preterite | 
|---|
 | I flickered |  | you flickered |  | he/she/it flickered |  | we flickered |  | you flickered |  | they flickered | 
 | Present Continuous | 
|---|
 | I am flickering |  | you are flickering |  | he/she/it is flickering |  | we are flickering |  | you are flickering |  | they are flickering | 
 | Present Perfect | 
|---|
 | I have flickered |  | you have flickered |  | he/she/it has flickered |  | we have flickered |  | you have flickered |  | they have flickered | 
 | Past Continuous | 
|---|
 | I was flickering |  | you were flickering |  | he/she/it was flickering |  | we were flickering |  | you were flickering |  | they were flickering | 
 | Past Perfect | 
|---|
 | I had flickered |  | you had flickered |  | he/she/it had flickered |  | we had flickered |  | you had flickered |  | they had flickered | 
 | Future | 
|---|
 | I will flicker |  | you will flicker |  | he/she/it will flicker |  | we will flicker |  | you will flicker |  | they will flicker | 
 | Future Perfect | 
|---|
 | I will have flickered |  | you will have flickered |  | he/she/it will have flickered |  | we will have flickered |  | you will have flickered |  | they will have flickered | 
 | Future Continuous | 
|---|
 | I will be flickering |  | you will be flickering |  | he/she/it will be flickering |  | we will be flickering |  | you will be flickering |  | they will be flickering | 
 | Present Perfect Continuous | 
|---|
 | I have been flickering |  | you have been flickering |  | he/she/it has been flickering |  | we have been flickering |  | you have been flickering |  | they have been flickering | 
 | Future Perfect Continuous | 
|---|
 | I will have been flickering |  | you will have been flickering |  | he/she/it will have been flickering |  | we will have been flickering |  | you will have been flickering |  | they will have been flickering | 
 | Past Perfect Continuous | 
|---|
 | I had been flickering |  | you had been flickering |  | he/she/it had been flickering |  | we had been flickering |  | you had been flickering |  | they had been flickering | 
 | Conditional | 
|---|
 | I would flicker |  | you would flicker |  | he/she/it would flicker |  | we would flicker |  | you would flicker |  | they would flicker | 
 Thesaurus| Past Conditional | 
|---|
 | I would have flickered |  | you would have flickered |  | he/she/it would have flickered |  | we would have flickered |  | you would have flickered |  | they would have flickered | 
 | Noun | 1. |  flicker - a momentary flash of light glint, sparkflash - a sudden intense burst of radiant energy |  |  | 2. | flicker - North American woodpeckerpeckerwood, woodpecker, pecker - bird with strong claws and a stiff tail adapted for climbing and a hard chisel-like bill for boring into wood for insectsColaptes, genus Colaptes - a genus of PicidaeColaptes auratus, yellowhammer, yellow-shafted flicker - large flicker of eastern North America with a red neck and yellow undersurface to wings and tailColaptes chrysoides, gilded flicker - southwestern United States bird like the yellow-shafted flicker but lacking the red neckColaptes caper collaris, red-shafted flicker - western United States bird with red undersurface to wings and tail |  |  | 3. |  flicker - the act of moving back and forth flutter, wavermovement, motility, motion, move - a change of position that does not entail a change of location; "the reflex motion of his eyebrows revealed his surprise"; "movement is a sign of life"; "an impatient move of his hand"; "gastrointestinal motility" |  | Verb | 1. | flicker - move back and forth very rapidly; "the candle flickered"flitter, flutter, quiver, wavermove back and forth - move in one direction and then into the opposite direction |  |  | 2. | flicker - shine unsteadily; "The candle flickered"flickbeam, shine - emit light; be bright, as of the sun or a light; "The sun shone bright that day"; "The fire beamed on their faces" |  |  | 3. | flicker - flash intermittently; "The lights flicked on and off"flickflash, twinkle, wink, winkle, blink - gleam or glow intermittently; "The lights were flashing" | 
 flickerverb1. twinkle, flash, sparkle, flare, shimmer, gutter, glimmer Firelight flickered on the faded furnishings.2. flutter, waver, quiver, vibrate Her eyelids flickered then opened.noun1. glimmer, flash, spark, flare, gleam I saw the flicker of flames.2. trace, drop, breath, spark, atom, glimmer, vestige, iota He felt a flicker of regret.flickerverb1. To move quickly, lightly, and irregularly like a bird in flight:flit, flitter, flutter, hover.2. To shine with intermittent gleams:blink, flash, glimmer, twinkle, wink.nounA sudden quick light:blink, coruscation, flash, glance, gleam, glimmer, glint, spark, twinkle, wink.Translationsflicker(ˈflikə)  verb1.  to burn unsteadily. the candle flickered. 閃爍 闪烁2.  to move quickly and unsteadily. A smile flickered across her face. 閃現 闪现 noun an unsteady light or flame. the flicker of an oil lamp. 閃爍不定 闪烁不定IdiomsSeeflicker outflicker
 flicker:see woodpeckerwoodpecker,common name for members of the Picidae, a large family of climbing birds found in most parts of the world. Woodpeckers typically have sharp, chisellike bills for pecking holes in tree trunks, and long, barbed, extensible tongues with which they impale their insect
 ..... Click the link for more information. .
 FlickerMomentary loss of light due to the fluctuation or loss of AC power.flicker[′flik·ər]  (optics) A visual sensation produced by periodic fluctuations in light at rates ranging from a few cycles per second to a few tens of cycles per second.flicker1 Television a visual sensation, often seen in a television image, produced by periodic fluctuations in the brightness of light at a frequency below that covered by the persistence of vision
 flicker2 any North American woodpecker of the genus Colaptes, esp C. auratus (yellow-shafted flicker), which has a yellow undersurface to the wings and tailflickerAn irregular sequence of frames in a movie or video image. The first flicker effect came from movie projectors that were out of synchronization with the film frames. See judder, interlace and flicker fusion rate.flickerRelated to flicker: Flickr
 Synonyms for flickerverb twinkleSynonymstwinkleflashsparkleflareshimmergutterglimmer
 verb flutterSynonymsflutterwaverquivervibrate
 noun glimmerSynonymsglimmerflashsparkflaregleam
 noun traceSynonymstracedropbreathsparkatomglimmervestigeiota
 Synonyms for flickerverb to move quickly, lightly, and irregularly like a bird in flightSynonymsverb to shine with intermittent gleamsSynonymsblinkflashglimmertwinklewink
 noun a sudden quick lightSynonymsblinkcoruscationflashglancegleamglimmerglintsparktwinklewink
 Synonyms for flickernoun a momentary flash of lightSynonymsRelated Wordsnoun North American woodpeckerRelated WordspeckerwoodwoodpeckerpeckerColaptesgenus ColaptesColaptes auratusyellowhammeryellow-shafted flickerColaptes chrysoidesgilded flickerColaptes caper collarisred-shafted flicker
 noun the act of moving back and forthSynonymsRelated Wordsmovementmotilitymotionmove
 verb move back and forth very rapidlySynonymsflitterflutterquiverwaver
 Related Wordsverb shine unsteadilySynonymsRelated Wordsverb flash intermittentlySynonymsRelated Wordsflashtwinklewinkwinkleblink
 |