| 单词 | run |
| 释义 | Run nnoun.acta score in baseball made by a runner touching all four bases safely Synset:tally Examples:
Derivationally Related Form:runtally Hypernyms:score Inherited Hypernyms:runscoresuccessattainmentaccomplishmentactionacteventpsychological featureabstractionentity Direct Hyponyms:earned runrbirun batted inunearned run Full Hyponyms: earned runrun batted inunearned run nnoun.actthe act of testing something Synset:test trial Examples:
Derivationally Related Form:testrun Hypernyms:attempt effort endeavor endeavour try Inherited Hypernyms:testattemptactivityacteventpsychological featureabstractionentity Direct Hyponyms:MOTMOT testMinistry of Transportation testSnellen testassayauditionclinical testclinical trialdouble blindfield trialfittingpilot programpilot projectpreclinical phasepreclinical testpreclinical trialtry-ontrying ontryout Full Hyponyms: agglutination testassayauditionbioassaybiopsyblood testchorionic villus samplingclinical trialcloze procedurecomplement fixation testdiagnostic testdick testdouble blindenzyme-linked-immunosorbent serologic assayfecal occult testfield trialfittingfriedman testgi seriesglucose tolerance testheterophil testimmunoassayimmunohistochemistryintradermal testmantoux testmotneedle biopsypap testpatch testphase i clinical trialphase ii clinical trialphase iii clinical trialphase iv clinical trialpilot projectpku testpreclinical trialpregnancy testpsa blood testqueckenstedt's testradioactive iodine excretion testradioactive iodine testradioactive iodine uptake testradioimmunoassayrubin testschick testscratch testscreen testskin testsnellen testtine testtissue typingtuberculin testvital capacitywassermann testwidal test nnoun.eventa race run on foot Synset:foot race footrace Examples:
Derivationally Related Form:run Hypernyms:race Inherited Hypernyms:footraceracecontestsocial eventeventpsychological featureabstractionentity Direct Hyponyms:fun runfunrunmarathonobstacle racesteeplechasetrack event Full Hyponyms: dashfunrunhurdlesmarathonmileobstacle racesteeplechasetrack event nnoun.groupan unbroken series of events Synset:streak Examples:
Hypernyms:succession Inherited Hypernyms:streaksuccessionseriesorderingarrangementgroupabstractionentity Direct Hyponyms:losing streakwinning streak Full Hyponyms: losing streakwinning streak nnoun.act(American football) a play in which a player attempts to carry the ball through or past the opposing team Topic:American footballAmerican football game Synset:running running game running play Examples:
Derivationally Related Form:run Hypernyms:football play Inherited Hypernyms:runfootball playplayplan of actionplanideacontentcognitionpsychological featureabstractionentity Direct Hyponyms:drawdraw playend runreturnreverserushrushingsweep Full Hyponyms: double reversedrawend runreturnreverserush nnoun.acta regular trip Examples:
Derivationally Related Form:run Hypernyms:trip Inherited Hypernyms:runtripjourneytravelmotionchangeactionacteventpsychological featureabstractionentity nnoun.actthe act of running; traveling on foot at a fast pace Synset:running Examples:
Derivationally Related Form:run Hypernyms:locomotion travel Inherited Hypernyms:runlocomotionmotionchangeactionacteventpsychological featureabstractionentity Direct Hyponyms:dashsprint Full Hyponyms: breakdashfast break nnoun.timethe continuous period of time during which something (a machine or a factory) operates or continues in operation Examples:
Hypernyms:period period of time time period Inherited Hypernyms:runtime periodfundamental quantitymeasureabstractionentity Direct Hyponyms:press runprint runrun-time Full Hyponyms: print runrun-timesplit run nnoun.stateunrestricted freedom to use Examples:
Derivationally Related Form:run Hypernyms:liberty Inherited Hypernyms:runlibertyfreedomstateattributeabstractionentity nnoun.quantitythe production achieved during a continuous period of operation (of a machine or factory etc.) Examples:
Hypernyms:indefinite quantity Inherited Hypernyms:runindefinite quantitymeasureabstractionentity nnoun.objecta small stream Synset:rill rivulet runnel streamlet Derivationally Related Form:streamrun Hypernyms:stream watercourse Inherited Hypernyms:rivuletstreambody of waterthingphysical entityentity nnoun.eventa race between candidates for elective office Synset:campaign political campaign Examples:
Derivationally Related Form:runcampaign Hypernyms:race Inherited Hypernyms:political campaignracecontestsocial eventeventpsychological featureabstractionentity Direct Hyponyms:campaign for governorgovernor's racesenate campaignsenate race Full Hyponyms: governor's racesenate campaign nnoun.eventa row of unravelled stitches Synset:ladder ravel Examples:
Derivationally Related Form:ladderravelrun Hypernyms:damage harm impairment Inherited Hypernyms:rundamagechangehappeningeventpsychological featureabstractionentity nnoun.eventthe pouring forth of a fluid Synset:discharge outpouring Derivationally Related Form:runrunnydischarge Hypernyms:flow flowing Inherited Hypernyms:dischargeflowchange of locationmovementhappeningeventpsychological featureabstractionentity Direct Hyponyms:escapejetleakleakageoutflowspirtspurtsquirt Full Hyponyms: escapejetsprayspritz nnoun.attributean unbroken chronological sequence Examples:
Hypernyms:chronological sequence chronological succession sequence succession successiveness Inherited Hypernyms:runsequencetemporal arrangementtemporal propertypropertyattributeabstractionentity nnoun.acta short trip Examples:
Derivationally Related Form:run Hypernyms:trip Inherited Hypernyms:runtripjourneytravelmotionchangeactionacteventpsychological featureabstractionentity vverb.motionmove fast by using one's feet, with one foot off the ground at any given time Examples:
Derivationally Related Form:runningrunnerrun Hypernyms:hurry speed travel rapidly zip Inherited Hypernyms:runtravel rapidlytravel Direct Hyponyms:clipharejoglopeoutrunromprunrun basesrushscamperscurryscuttleskittersprintstreaktrot Full Troponyms:crabharejoglopeoutrunromprunrun basesrushscurrysprintstreaktrot Sentence Frame:Something ---s | Somebody ---s | Somebody ---s PP | The horses --- across the field (apply to: run) vverb.motionflee; take to one's heels; cut and run Synset:break away bunk escape fly the coop head for the hills hightail it lam run away scarper scat take to the woods turn tail Examples:
Derivationally Related Form:runawaylam Hypernyms:go away go forth leave Inherited Hypernyms:scatleave Direct Hyponyms:fleeflyskedaddletake flight Full Troponyms:abscondbreakdefectelopeeludeescapeexfiltratefleehigh-taillevantratrun awayshakeskedaddleslipstampede Sentence Frame:Something ---s | Somebody ---s | Somebody ---s PP vverb.stativestretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point Synset:extend go lead pass Examples:
Derivationally Related Form:extent Hypernyms:be Inherited Hypernyms:runbe Direct Hyponyms:comego deepgo farradiaterayunderrun Full Troponyms:comego farradiateunderrun Sentence Frame:Something is ---ing PP vverb.socialdirect or control; projects, businesses, etc. Synset:operate Examples:
Derivationally Related Form:operatoroperationrunning Hypernyms:direct Inherited Hypernyms:operatedirectmanagecontrol Direct Hyponyms:blockfinancierwarm upwork Full Troponyms:blockfinancierwarm upwork Sentence Frame:Somebody ---s something vverb.stativehave a particular form Synset:go Examples:
Hypernyms:be Inherited Hypernyms:runbe Sentence Frame:Something ---s vverb.motionmove along, of liquids Synset:course feed flow Examples:
Derivationally Related Form:runflowcourseflowing Hypernyms:move Inherited Hypernyms:runmove Direct Hyponyms:circulatedraindribbleeddyfilterflushgushgutterjetoozepourpurlrun downrun offrun outseepspillstreamsurgeswirltidetricklewastewell outwhirlwhirlpool Full Troponyms:blowcentrifugecirculatedraineddyflushgeysergutterjetleachoverflowpourpumpregurgitaterun downseepspillspinspurtstreamtidetrickleultracentrifugeventilatewash downwastewhoosh Sentence Frame:Something ---s | Something is ---ing PP | Water and oil --- into the bowl (apply to: flow, run) vverb.contactperform as expected when applied Synset:function go operate work Examples:
Antonyms:malfunction Derivationally Related Form:operationoperantoperativefunctioning Inherited Hypernyms:function Direct Hyponyms:cutdoublerollrunserveservice Full Troponyms:cutdoublerollrunservice Sentence Frame:Something ---s | These cars won't --- (apply to: function, run, operate, go, work) vverb.stativechange or be different within limits Synset:range Examples:
Derivationally Related Form:range Hypernyms:be Inherited Hypernyms:rangebe Sentence Frame:Something ---s something vverb.competitionrun, stand, or compete for an office or a position Synset:campaign Examples:
Derivationally Related Form:campaignerruncampaign Hypernyms:race run Inherited Hypernyms:campaignracecompete Direct Hyponyms:cross-fileregisterrerunstumpwhistlestop Full Troponyms:cross-filererunslatestumpwhistlestop Sentence Frame:Somebody ---s | Somebody ---s PP vverb.creationcause to emit recorded audio or video Synset:play Examples:
Inherited Hypernyms:play Sentence Frame:Somebody ---s something | Something ---s something | Sam and Sue --- the movie (apply to: run, play) vverb.motionmove about freely and without restraint, or act as if running around in an uncontrolled way Examples:
Derivationally Related Form:run Hypernyms:go locomote move travel Inherited Hypernyms:runtravel Sentence Frame:Something is ---ing PP | Somebody ---s PP vverb.stativehave a tendency or disposition to do or be something; be inclined Synset:be given incline lean tend Examples:
Derivationally Related Form:tendencyinclination Hypernyms:be Inherited Hypernyms:tendbe Direct Hyponyms:gravitatesuffertake kindly to Full Troponyms:gravitatesuffertake kindly to Sentence Frame:Somebody ---s to INFINITIVE vverb.contactbe operating, running or functioning Examples:
Antonyms:idle Derivationally Related Form:running Hypernyms:function go operate run work Inherited Hypernyms:runfunction Sentence Frame:Something ---s vverb.changechange from one state to another Examples:
Hypernyms:become get go Inherited Hypernyms:runbecomechange statechange Sentence Frame:Somebody ---s something | Something ---s something | Something ---s Adjective/Noun | Somebody ---s Adjective vverb.changecause to perform Examples:
Hypernyms:process treat Inherited Hypernyms:runprocessaffectchange Direct Hyponyms:rerun Full Troponyms:rerun Sentence Frame:Somebody ---s something | Somebody ---s somebody vverb.stativebe affected by; be subjected to Examples:
Hypernyms:incur Inherited Hypernyms:runincursubjectaffectchange Sentence Frame:Somebody ---s something vverb.stativecontinue to exist Synset:die hard endure persist prevail Examples:
Derivationally Related Form:diehardprevalenceprevalentpersistent Hypernyms:continue Inherited Hypernyms:prevailcontinuebe Direct Hyponyms:carry overreverberate Full Troponyms:carry overreverberate Sentence Frame:Something ---s vverb.stativeoccur persistently Examples:
Hypernyms:occur Inherited Hypernyms:runoccurappear Sentence Frame:Something is ---ing PP vverb.socialcarry out a process or program, as on a computer or a machine Synset:execute Examples:
Derivationally Related Form:executive Hypernyms:apply enforce implement Inherited Hypernyms:runenforcecompelinduce Direct Hyponyms:step Full Troponyms:step Sentence Frame:Somebody ---s something | Something ---s something vverb.creationinclude as the content; broadcast or publicize Synset:carry Examples:
Hypernyms:broadcast circularise circularize circulate diffuse disperse disseminate distribute pass around propagate spread Inherited Hypernyms:carrycirculatepublicizetellinformcommunicateinteractact Sentence Frame:Somebody ---s something | Something ---s something vverb.creationcarry out Examples:
Hypernyms:accomplish action carry out carry through execute fulfil fulfill Inherited Hypernyms:runcarry throughcompleteendchange Inherited Hypernyms:runcarry througheffectcausemake Sentence Frame:Somebody ---s something vverb.contactpass over, across, or through Synset:draw guide pass Examples:
Inherited Hypernyms:guide Direct Hyponyms:rubthread Full Troponyms:brushdustgaugegrateholystonepawpumicepureeresmudgerosinrubscourscrapescrubsmearspongesponge downsqueegeesweepthreadtowelwhiskwipeworry Sentence Frame:Somebody ---s something PP vverb.stativecause something to pass or lead somewhere Synset:lead Examples:
Hypernyms:make pass pass Inherited Hypernyms:runpass Sentence Frame:Somebody ---s something PP vverb.socialmake without a miss Topic:athleticssport Derivationally Related Form:run Hypernyms:bring home the bacon come through deliver the goods succeed win Inherited Hypernyms:runsucceed Sentence Frame:Somebody ---s something vverb.possessiondeal in illegally, such as arms or liquor Topic:crimecriminal offencecriminal offenselaw-breaking Synset:black market Derivationally Related Form:runblack market Hypernyms:merchandise trade Inherited Hypernyms:runtrade Sentence Frame:Somebody ---s something vverb.motioncause an animal to move fast Examples:
Derivationally Related Form:run Hypernyms:displace move Inherited Hypernyms:runmove Sentence Frame:Somebody ---s something | Something ---s something | The men --- the horses across the field (apply to: run) vverb.motionbe diffused Synset:bleed Examples:
Hypernyms:diffuse fan out spread spread out Inherited Hypernyms:rundiffusespread Direct Hyponyms:crock Full Troponyms:crock Sentence Frame:Something ---s vverb.motionsail before the wind Hypernyms:sail Inherited Hypernyms:runsailboatridetraveltravel Sentence Frame:Something ---s | Somebody ---s vverb.motioncover by running; run a certain distance Examples:
Derivationally Related Form:run Hypernyms:pass Inherited Hypernyms:runpasstravel Sentence Frame:Somebody ---s something vverb.stativeextend or continue for a certain period of time Synset:run for Examples:
Hypernyms:endure last Inherited Hypernyms:runlastmeasurebe Sentence Frame:Something ---s something vverb.socialset animals loose to graze Hypernyms:free liberate loose release unloose unloosen Inherited Hypernyms:runfree Sentence Frame:Somebody ---s something vverb.motionkeep company Synset:consort Examples:
Derivationally Related Form:consort Hypernyms:accompany Inherited Hypernyms:runaccompanytravel Sentence Frame:Something is ---ing PP vverb.motionrun with the ball; in such sports as football Topic:athleticssport Derivationally Related Form:runningrun Hypernyms:run Inherited Hypernyms:runruntravel rapidlytravel Sentence Frame:Somebody ---s vverb.motiontravel rapidly, by any (unspecified) means Examples:
Derivationally Related Form:run Hypernyms:go locomote move travel Inherited Hypernyms:runtravel Sentence Frame:Somebody ---s | Somebody ---s PP vverb.motiontravel a route regularly Synset:ply Examples:
Derivationally Related Form:plierrun Hypernyms:jaunt travel trip Inherited Hypernyms:plytravel Sentence Frame:Something is ---ing PP | Somebody ---s PP vverb.competitionpursue for food or sport (as of wild animals) Synset:hunt hunt down track down Examples:
Derivationally Related Form:hunthunterhunting Hypernyms:capture catch Inherited Hypernyms:huntcaptureget Direct Hyponyms:ambushcoursedrivefalconferretforagefowlfoxhunthawkjackjacklightpoachrabbitscroungesealsnipestill-huntturtlewhale Full Troponyms:coursedrivefalconferretfowlfoxhuntgrousehawkjacklightpoachrabbitrustlescroungesealsnipestill-huntturtlewhale Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s | The men --- for animals in the area (apply to: hunt) | The men --- the area for animals (apply to: hunt) vverb.competitioncompete in a race Synset:race Examples:
Derivationally Related Form:racingracerracerunningrunnerrun Hypernyms:compete contend vie Inherited Hypernyms:racecompete Direct Hyponyms:boat-racecampaignhorse-raceplacerunshowspeed skate Full Troponyms:boat-racecampaigncross-filehorse-racejockeyplacererunshowslatespeed skatestumpwhistlestop Sentence Frame:Somebody ---s | Somebody ---s PP | These cars won't --- (apply to: race, run) vverb.changeprogress by being changed Synset:go move Examples:
Derivationally Related Form:run Hypernyms:change Inherited Hypernyms:movechange Sentence Frame:Something is ---ing PP | Somebody ---s PP vverb.changereduce or cause to be reduced from a solid to a liquid state, usually by heating Synset:melt melt down Examples:
Derivationally Related Form:meltmeltablemelting Hypernyms:break up dissolve resolve Inherited Hypernyms:meltdissolvechange integritychange Direct Hyponyms:fuserendertry Full Troponyms:fusetry Sentence Frame:Somebody ---s something | Something ---s | Something ---s something vverb.changecome unraveled or undone as if by snagging Synset:ladder Examples:
Derivationally Related Form:ladderrun Hypernyms:break come apart fall apart separate split up Inherited Hypernyms:ladderbreakchange integritychange Sentence Frame:Something ---s vverb.changebecome undone Synset:unravel Examples:
Derivationally Related Form:unravellerrun Hypernyms:disintegrate Inherited Hypernyms:rundisintegratechange integritychange Sentence Frame:Something ---s |
| 随便看 |
英语词典包含147479条英英释义在线翻译词条，基本涵盖了全部常用单词的英英翻译及用法，是英语学习的有利工具。